PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G203000.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 325aa    MW: 34983.3 Da    PI: 5.5356
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G203000.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15254297548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  Sevir.3G203000.4.p 254 RRQKRMIKNRESAARSRARKQAYTNELENKVSLLEEENERLKKQ 297
                         69***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.3E-15249297No hitNo description
SMARTSM003384.2E-12250322IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.542252297IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-12254299No hitNo description
CDDcd147073.64E-26254299No hitNo description
PfamPF001705.2E-14254297IPR004827Basic-leucine zipper domain
PROSITE patternPS000360257272IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MASQAGGGGG GDAGSAQRGQ IQGLARQGSL YNLTLDEVQN HLGEPLLSMN FDDLLKTVFP  60
DGVDPNGPVI GKPDPASSLQ RQGSIVMPPQ LSKKTVDEVW KGIQDGPETS AREGGRHRRE  120
RQPTLGEMTL EDFLVKAGVV PEGLMRDSDD LLVNMDTVGS NVMVAGTSSL NPGAQLLQQY  180
QQQALESQQP SLVGSYMAGQ LAPQPLSVAT GAMLDSMYSD GQITSPTLGA FSDPQTPGRK  240
RGVSGEVVDK VIERRQKRMI KNRESAARSR ARKQAYTNEL ENKVSLLEEE NERLKKQKEF  300
GEILSSAPPP EPKYQLRRTS SSAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0613450.0BT061345.1 Zea mays full-length cDNA clone ZM_BFb0137L05 mRNA, complete cds.
GenBankEU9663890.0EU966389.1 Zea mays clone 294076 bZIP transcription factor mRNA, complete cds.
GenBankKJ7269130.0KJ726913.1 Zea mays clone pUT3458 bZIP transcription factor (bZIP96) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961686.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X3
SwissprotQ9LES32e-80AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLK3Z7W90.0K3Z7W9_SETIT; Uncharacterized protein
STRINGSi022639m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-79ABA-responsive element binding protein 3